PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32611.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 577aa    MW: 65024 Da    PI: 6.3177
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32611.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.92e-071449148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++ Ed++l+d+vk++G            +gR++k++++rw++yl
  mrna32611.1-v1.0-hybrid 14 KGKWSAGEDQILKDYVKKHG------------LGRCGKSVRLRWFNYL 49
                             79******************............479***********97 PP

2Myb_DNA-binding38.72.3e-125998546
                             -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              ++E++l+++ +k+ G++ W++Ia +++ gRt++++k++w +
  mrna32611.1-v1.0-hybrid 59 REDEEDLIIRMHKLIGKR-WSLIAGRIP-GRTDNEIKNYWIS 98
                             589***************.*********.***********76 PP

3Myb_DNA-binding38.62.5e-12380419546
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               ++E++l+++ +k+ G++ W++Ia +++ gRt++++k++w +
  mrna32611.1-v1.0-hybrid 380 REDEEDLIIRMHKLVGKR-WSLIAGRIP-GRTDNEIKNYWIS 419
                              589***************.*********.***********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.1E-211196IPR009057Homeodomain-like
SMARTSM007173.6E-51351IPR001005SANT/Myb domain
PfamPF002498.1E-61449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-131556IPR009057Homeodomain-like
PROSITE profilePS5129421.64750104IPR017930Myb domain
SMARTSM007171.1E-1154102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2057104IPR009057Homeodomain-like
CDDcd001672.08E-860100No hitNo description
PfamPF002491.2E-106098IPR001005SANT/Myb domain
PROSITE profilePS500904.252335370IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.0E-10341377IPR009057Homeodomain-like
SuperFamilySSF466896.27E-17356426IPR009057Homeodomain-like
PROSITE profilePS5129422.173371425IPR017930Myb domain
SMARTSM007174.0E-12375423IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-20378425IPR009057Homeodomain-like
CDDcd001678.38E-9381421No hitNo description
PfamPF002491.2E-10381419IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MGKTSGFEKE GKKKGKWSAG EDQILKDYVK KHGLGRCGKS VRLRWFNYLR PDIKHGNIRE  60
DEEDLIIRMH KLIGKRWSLI AGRIPGRTDN EIKNYWISTL SKKLAEEKRK KPEVPRNGIA  120
KESLPAPIEI DDGHPHPTKC NEVPGGGGLV CFASNVNVEE DHQHQSRDTD NSTTMSAGVG  180
VQIRGVANNV QPTGDDLNDD AMPWNDWITD LNEGQLDLSE FLQTDFSNFW EESDMLMNFE  240
VGGCSTINHE WPNNCVVKYH PELLVFLSVR TSVPFYGADF RPFTTVRRRR GRASTPADSS  300
SFPDHFPSPM SPPNSNFPTR LTLFEVLSDL AGKLEFGGLT GDGKWSGKLL ESAGLGRCGR  360
SVRLRWLNYL RPDIKHGNIR EDEEDLIIRM HKLVGKRWSL IAGRIPGRTD NEIKNYWIST  420
LSKKLAEEKR KKPKVPRNET AEESLPSPIE VDDGHPYPTK CNEVPGGGGG LMCFASNVNV  480
EEDHQHQRRD TNNSTTMSAG MGVRIRGVAN NVQPNGDDLS YDPVPWNDWI MDLNGGQLDI  540
SEFLQTGFFN FWEELDMFMN FEVGGCSTIN HEWQNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-19144257108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289469.10.0PREDICTED: transcription factor WER-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2574423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-36myb domain protein 66